PDB entry 1flz

View 1flz on RCSB PDB site
Description: uracil dna glycosylase with uaap
Deposited on 2000-08-15, released 2001-01-17
The last revision prior to the SCOP 1.71 freeze date was dated 2001-01-17, with a file datestamp of 2001-01-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1flza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flzA (A:)
    aneltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
    gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
    lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
    vlkaphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese