PDB entry 1fly

View 1fly on RCSB PDB site
Description: hen egg white lysozyme mutant with alanine substituted for glycine
Class: hydrolase
Keywords: HEN LYSOZYME, ALANINE SCANNING, hydrolase
Deposited on 2000-08-15, released 2000-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.171
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered (101)
    Domains in SCOPe 2.06: d1flya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flyA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdangmnawvawrnrckgtdv
    qawirgcrl