PDB entry 1flw

View 1flw on RCSB PDB site
Description: hen egg white lysozyme mutant with alanine substituted for glycine
Class: hydrolase
Keywords: hen lysozyme, alanine scanning
Deposited on 2000-08-15, released 2000-09-06
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.165
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: GALLUS GALLUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered (70)
    Domains in SCOP 1.75: d1flwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flwA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpasrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl