PDB entry 1flv

View 1flv on RCSB PDB site
Description: structure of the oxidized long chain flavodoxin from anabaena 7120 at 2 angstroms resolution
Class: electron transport
Keywords: electron transport
Deposited on 1992-07-02, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Nostoc sp. [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1flva_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1flvA (A:)
    skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
    elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1flvA (A:)
    kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl