PDB entry 1flr

View 1flr on RCSB PDB site
Description: 4-4-20 fab fragment
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1995-01-19, released 1995-09-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 4-4-20 (ig*g2a=kappa=) fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1flrh1, d1flrh2
  • Chain 'L':
    Compound: 4-4-20 (ig*g2a=kappa=) fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB09710 (0-218)
      • conflict (1)
      • conflict (6)
      • conflict (28)
      • conflict (38)
      • conflict (40)
      • conflict (50)
      • conflict (91)
      • conflict (93)
      • conflict (95-96)
      • conflict (216)
    Domains in SCOPe 2.03: d1flrl1, d1flrl2
  • Heterogens: FLU, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1flrH (H:)
    evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
    yysdsvkgrftisrddskssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1flrH (H:)
    evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
    yysdsvkgrftisrddssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvssaktt
    apsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flrL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylrwylqkpgqspkvliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec