PDB entry 1flr

View 1flr on RCSB PDB site
Description:
Deposited on 1995-01-19, released 1995-09-15
The last revision prior to the SCOP 1.65 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.188
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1flrh1, d1flrh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1flrl1, d1flrl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1flrH (H:)
    evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
    yysdsvkgrftisrddskssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1flrH (H:)
    evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
    yysdsvkgrftisrddssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvssaktt
    apsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flrL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylrwylqkpgqspkvliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec