PDB entry 1fln

View 1fln on RCSB PDB site
Description: clostridium beijerinckii flavodoxin mutant: d58p reduced
Deposited on 1996-12-18, released 1997-03-12
The last revision prior to the SCOP 1.71 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1fln__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fln_ (-)
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamgpev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiani