PDB entry 1flg

View 1flg on RCSB PDB site
Description: crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa
Class: oxidoreductase
Keywords: quinoprotein, superbarrel, dehydrogenase, oxidoreductase
Deposited on 2000-08-14, released 2000-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.142
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (quinoprotein ethanol dehydrogenase)
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1flga_
  • Chain 'B':
    Compound: protein (quinoprotein ethanol dehydrogenase)
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1flgb_
  • Heterogens: CA, PQQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flgA (A:)
    kdvtwedianddkttgdvlqygmgthaqrwsplkqvnadnvfkltpawsysfgdekqrgq
    esqaivsdgviyvtasysrlfaldaktgkrlwtynhrlpddirpccdvvnrgaaiygdkv
    ffgtldasvvalnkntgkvvwkkkfadhgagytmtgaptivkdgktgkvllihgssgdef
    gvvgrlfardpdtgeeiwmrpfveghmgrlngkdstvtgdvkapswpddrnsptgkvesw
    shgggapwqsasfdaetntiivgagnpgpwntwartakggnphdydslytsgqvgvdpss
    gevkwfyqhtpndawdfsgnnelvlfdykakdgkivkatahadrngffyvvdrsngklqn
    afpfvdnitwashidlktgrpveregqrpplpepgqkhgkavevsppflggknwnpmays
    qdtglfyvpanhwkedywteevsytkgsaylgmgfrikrmyddhvgslramdpvsgkvvw
    ehkehlplwagvlatagnlvftgtgdgyfkafdaksgkelwkfqtgsgivsppitweqdg
    eqylgvtvgyggavplwggdmadltrpvaqggsfwvfklpsw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flgB (B:)
    kdvtwedianddkttgdvlqygmgthaqrwsplkqvnadnvfkltpawsysfgdekqrgq
    esqaivsdgviyvtasysrlfaldaktgkrlwtynhrlpddirpccdvvnrgaaiygdkv
    ffgtldasvvalnkntgkvvwkkkfadhgagytmtgaptivkdgktgkvllihgssgdef
    gvvgrlfardpdtgeeiwmrpfveghmgrlngkdstvtgdvkapswpddrnsptgkvesw
    shgggapwqsasfdaetntiivgagnpgpwntwartakggnphdydslytsgqvgvdpss
    gevkwfyqhtpndawdfsgnnelvlfdykakdgkivkatahadrngffyvvdrsngklqn
    afpfvdnitwashidlktgrpveregqrpplpepgqkhgkavevsppflggknwnpmays
    qdtglfyvpanhwkedywteevsytkgsaylgmgfrikrmyddhvgslramdpvsgkvvw
    ehkehlplwagvlatagnlvftgtgdgyfkafdaksgkelwkfqtgsgivsppitweqdg
    eqylgvtvgyggavplwggdmadltrpvaqggsfwvfklpsw