PDB entry 1fle

View 1fle on RCSB PDB site
Description: crystal structure of elafin complexed with porcine pancreatic elastase
Class: complex (serine protease/inhibitor)
Keywords: hydrolase, serine protease, 3d-structure, zymogen, pancreas, signal, complex (serine protease/inhibitor)
Deposited on 1996-07-04, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: elastase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • conflict (65)
    Domains in SCOPe 2.07: d1flee_
  • Chain 'I':
    Compound: elafin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1flei_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fleE (E:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1fleI (I:)
    aqepvkgpvstkpgscpiilircamlnppnrclkdtdcpgikkccegscgmacfvpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fleI (I:)
    tkpgscpiilircamlnppnrclkdtdcpgikkccegscgmacfvpq