PDB entry 1flc

View 1flc on RCSB PDB site
Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus
Deposited on 1999-02-22, released 2000-02-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-01, with a file datestamp of 2000-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.223
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flcA (A:)
    ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
    ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
    haaincyrknwtdiklnfqkniyelasqshcmslvnaldktiplqvtagtagncnnsflk
    npalytqevkpsenkcgkenlafftlptqfgtyecklhlvascyfiydskevynkrgcdn
    yfqviydsfgkvvggldnrvspytgnsgdtptmqcdmlqlkpgrysvrssprfllmpers
    ycfdmkekgpvtavqsiwgkgresdyavdqaclstpgcmliqkqkpyigeaddhhgdqem
    rellsgldyearcisqsgwvnetspftekyllppkfgrcplaakeesipkipdgllipts
    gtdttvt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flcC (C:)
    ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
    ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
    haaincyrknwtdiklnfqkniyelasqshcmslvnaldktiplqvtagtagncnnsflk
    npalytqevkpsenkcgkenlafftlptqfgtyecklhlvascyfiydskevynkrgcdn
    yfqviydsfgkvvggldnrvspytgnsgdtptmqcdmlqlkpgrysvrssprfllmpers
    ycfdmkekgpvtavqsiwgkgresdyavdqaclstpgcmliqkqkpyigeaddhhgdqem
    rellsgldyearcisqsgwvnetspftekyllppkfgrcplaakeesipkipdgllipts
    gtdttvt
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flcE (E:)
    ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
    ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
    haaincyrknwtdiklnfqkniyelasqshcmslvnaldktiplqvtagtagncnnsflk
    npalytqevkpsenkcgkenlafftlptqfgtyecklhlvascyfiydskevynkrgcdn
    yfqviydsfgkvvggldnrvspytgnsgdtptmqcdmlqlkpgrysvrssprfllmpers
    ycfdmkekgpvtavqsiwgkgresdyavdqaclstpgcmliqkqkpyigeaddhhgdqem
    rellsgldyearcisqsgwvnetspftekyllppkfgrcplaakeesipkipdgllipts
    gtdttvt
    

  • Chain 'F':
    No sequence available.