PDB entry 1flc

View 1flc on RCSB PDB site
Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus
Class: hydrolase
Keywords: esterase, receptor binding, membrane fusion, virus, influenza, hydrolase
Deposited on 1999-02-22, released 2000-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haemagglutinin-esterase-fusion glycoprotein
    Species: Influenza C virus [TaxId:100673]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1flca1, d1flca2
  • Chain 'B':
    Compound: haemagglutinin-esterase-fusion glycoprotein
    Species: Influenza C virus [TaxId:100673]
    Database cross-references and differences (RAF-indexed):
    • GB M17868
    Domains in SCOPe 2.07: d1flcb_
  • Chain 'C':
    Compound: haemagglutinin-esterase-fusion glycoprotein
    Species: Influenza C virus [TaxId:100673]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1flcc1, d1flcc2
  • Chain 'D':
    Compound: haemagglutinin-esterase-fusion glycoprotein
    Species: Influenza C virus [TaxId:100673]
    Database cross-references and differences (RAF-indexed):
    • GB M17868
    Domains in SCOPe 2.07: d1flcd_
  • Chain 'E':
    Compound: haemagglutinin-esterase-fusion glycoprotein
    Species: Influenza C virus [TaxId:100673]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1flce1, d1flce2
  • Chain 'F':
    Compound: haemagglutinin-esterase-fusion glycoprotein
    Species: Influenza C virus [TaxId:100673]
    Database cross-references and differences (RAF-indexed):
    • GB M17868
    Domains in SCOPe 2.07: d1flcf_
  • Heterogens: NDG, NAG, BMA, MAN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1flcA (A:)
    ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
    ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
    haaincyrknwtdiklnfqkniyelasqshcmslvnaldktiplqvtagtagncnnsflk
    npalytqevkpsenkcgkenlafftlptqfgtyecklhlvascyfiydskevynkrgcdn
    yfqviydsfgkvvggldnrvspytgnsgdtptmqcdmlqlkpgrysvrssprfllmpers
    ycfdmkekgpvtavqsiwgkgresdyavdqaclstpgcmliqkqkpyigeaddhhgdqem
    rellsgldyearcisqsgwvnetspftekyllppkfgrcplaakeesipkipdgllipts
    gtdttvtkpksr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1flcA (A:)
    ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
    ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
    haaincyrknwtdiklnfqkniyelasqshcmslvnaldktiplqvtagtagncnnsflk
    npalytqevkpsenkcgkenlafftlptqfgtyecklhlvascyfiydskevynkrgcdn
    yfqviydsfgkvvggldnrvspytgnsgdtptmqcdmlqlkpgrysvrssprfllmpers
    ycfdmkekgpvtavqsiwgkgresdyavdqaclstpgcmliqkqkpyigeaddhhgdqem
    rellsgldyearcisqsgwvnetspftekyllppkfgrcplaakeesipkipdgllipts
    gtdttvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1flcB (B:)
    ifgiddliigvlfvaivetgiggyllgsrkesgggvtkesaekgfekigndiqilkssin
    iaieklndrishdeqairdltleienarseallgelgiirallvgnisiglqeslwelas
    eitnragdlavevspgcwiidnnicdqscqnfifkfnetapvptippldtkidlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1flcB (B:)
    iddliigvlfvaivetgiggyllgsrkesgggvtkesaekgfekigndiqilkssiniai
    eklndrishdeqairdltleienarseallgelgiirallvgnisiglqeslwelaseit
    nragdlavevspgcwiidnnicdqscqnfifkfnetapvpti
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1flcC (C:)
    ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
    ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
    haaincyrknwtdiklnfqkniyelasqshcmslvnaldktiplqvtagtagncnnsflk
    npalytqevkpsenkcgkenlafftlptqfgtyecklhlvascyfiydskevynkrgcdn
    yfqviydsfgkvvggldnrvspytgnsgdtptmqcdmlqlkpgrysvrssprfllmpers
    ycfdmkekgpvtavqsiwgkgresdyavdqaclstpgcmliqkqkpyigeaddhhgdqem
    rellsgldyearcisqsgwvnetspftekyllppkfgrcplaakeesipkipdgllipts
    gtdttvtkpksr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1flcC (C:)
    ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
    ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
    haaincyrknwtdiklnfqkniyelasqshcmslvnaldktiplqvtagtagncnnsflk
    npalytqevkpsenkcgkenlafftlptqfgtyecklhlvascyfiydskevynkrgcdn
    yfqviydsfgkvvggldnrvspytgnsgdtptmqcdmlqlkpgrysvrssprfllmpers
    ycfdmkekgpvtavqsiwgkgresdyavdqaclstpgcmliqkqkpyigeaddhhgdqem
    rellsgldyearcisqsgwvnetspftekyllppkfgrcplaakeesipkipdgllipts
    gtdttvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1flcD (D:)
    ifgiddliigvlfvaivetgiggyllgsrkesgggvtkesaekgfekigndiqilkssin
    iaieklndrishdeqairdltleienarseallgelgiirallvgnisiglqeslwelas
    eitnragdlavevspgcwiidnnicdqscqnfifkfnetapvptippldtkidlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1flcD (D:)
    iddliigvlfvaivetgiggyllgsrkesgggvtkesaekgfekigndiqilkssiniai
    eklndrishdeqairdltleienarseallgelgiirallvgnisiglqeslwelaseit
    nragdlavevspgcwiidnnicdqscqnfifkfnetapvpti
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1flcE (E:)
    ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
    ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
    haaincyrknwtdiklnfqkniyelasqshcmslvnaldktiplqvtagtagncnnsflk
    npalytqevkpsenkcgkenlafftlptqfgtyecklhlvascyfiydskevynkrgcdn
    yfqviydsfgkvvggldnrvspytgnsgdtptmqcdmlqlkpgrysvrssprfllmpers
    ycfdmkekgpvtavqsiwgkgresdyavdqaclstpgcmliqkqkpyigeaddhhgdqem
    rellsgldyearcisqsgwvnetspftekyllppkfgrcplaakeesipkipdgllipts
    gtdttvtkpksr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1flcE (E:)
    ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
    ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
    haaincyrknwtdiklnfqkniyelasqshcmslvnaldktiplqvtagtagncnnsflk
    npalytqevkpsenkcgkenlafftlptqfgtyecklhlvascyfiydskevynkrgcdn
    yfqviydsfgkvvggldnrvspytgnsgdtptmqcdmlqlkpgrysvrssprfllmpers
    ycfdmkekgpvtavqsiwgkgresdyavdqaclstpgcmliqkqkpyigeaddhhgdqem
    rellsgldyearcisqsgwvnetspftekyllppkfgrcplaakeesipkipdgllipts
    gtdttvt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1flcF (F:)
    ifgiddliigvlfvaivetgiggyllgsrkesgggvtkesaekgfekigndiqilkssin
    iaieklndrishdeqairdltleienarseallgelgiirallvgnisiglqeslwelas
    eitnragdlavevspgcwiidnnicdqscqnfifkfnetapvptippldtkidlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1flcF (F:)
    iddliigvlfvaivetgiggyllgsrkesgggvtkesaekgfekigndiqilkssiniai
    eklndrishdeqairdltleienarseallgelgiirallvgnisiglqeslwelaseit
    nragdlavevspgcwiidnnicdqscqnfifkfnetapvpti