PDB entry 1fl6

View 1fl6 on RCSB PDB site
Description: the hapten complexed germline precursor to sulfide oxidase catalytic antibody 28b4
Class: immune system
Keywords: catalytic antibody, germline antibody, sulfide oxidase
Deposited on 2000-08-11, released 2001-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2001-11-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody germline precursor to 28b4
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1fl6a1, d1fl6a2
  • Chain 'B':
    Compound: antibody germline precursor to 28b4
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1fl6b1, d1fl6b2
  • Chain 'H':
    Compound: antibody germline precursor to 28b4
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1fl6h1, d1fl6h2
  • Chain 'L':
    Compound: antibody germline precursor to 28b4
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1fl6l1, d1fl6l2
  • Heterogens: AAH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl6A (A:)
    elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl6B (B:)
    qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl6H (H:)
    qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl6L (L:)
    elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg