PDB entry 1fl5

View 1fl5 on RCSB PDB site
Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.
Class: immune system
Keywords: catalytic antibody, germline antibody, sulfide oxidase
Deposited on 2000-08-11, released 2001-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2001-11-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody germline precursor to antibody 28b4
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1fl5a1, d1fl5a2
  • Chain 'B':
    Compound: antibody germline precursor to antibody 28b4
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1fl5b1, d1fl5b2
  • Chain 'H':
    Compound: antibody germline precursor to antibody 28b4
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1fl5h1, d1fl5h2
  • Chain 'L':
    Compound: antibody germline precursor to antibody 28b4
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1fl5l1, d1fl5l2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl5A (A:)
    elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl5B (B:)
    qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl5H (H:)
    qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl5L (L:)
    elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg