PDB entry 1fl5

View 1fl5 on RCSB PDB site
Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.
Deposited on 2000-08-11, released 2001-11-14
The last revision prior to the SCOP 1.69 freeze date was dated 2001-11-14, with a file datestamp of 2001-11-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl5A (A:)
    elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl5B (B:)
    qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl5H (H:)
    qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl5L (L:)
    elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg