PDB entry 1fl2

View 1fl2 on RCSB PDB site
Description: catalytic core component of the alkylhydroperoxide reductase ahpf from e.coli
Deposited on 2000-08-11, released 2001-03-21
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl2A (A:)
    aydvlivgsgpagaaaaiysarkgirtglmgerfggqildtvdienyisvpktegqklag
    alkvhvdeydvdvidsqsasklipaavegglhqietasgavlkarsiivatgakwrnmnv
    pgedqyrtkgvtycphcdgplfkgkrvavigggnsgveaaidlagivehvtllefapemk
    adqvlqdklrslknvdiilnaqttevkgdgskvvgleyrdrvsgdihnielagifvqigl
    lpntnwlegavernrmgeiiidakcetnvkgvfaagdcttvpykqiiiatgegakaslsa
    fdylirtkta