PDB entry 1fl0

View 1fl0 on RCSB PDB site
Description: crystal structure of the emap2/RNA-binding domain of the p43 protein from human aminoacyl-tRNA synthetase complex
Class: RNA binding protein
Keywords: RNA-binding domain, OB-fold, tRNA synthetase complex, RNA BINDING PROTEIN
Deposited on 2000-08-11, released 2000-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothelial-monocyte activating polypeptide II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12904 (0-162)
      • expression tag (163)
    Domains in SCOPe 2.08: d1fl0a1, d1fl0a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1fl0A (A:)
idvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvil
lcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkkk
iweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgiklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1fl0A (A:)
idvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvil
lcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkkk
iweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgikl