PDB entry 1fkx

View 1fkx on RCSB PDB site
Description: murine adenosine deaminase (d296a)
Class: aminohydrolase
Keywords: zinc cofactor, tim barrel, aminohydrolase
Deposited on 1996-02-29, released 1996-08-01
The last revision prior to the SCOP 1.75 freeze date was dated 1996-08-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.158
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine deaminase
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03958 (0-348)
      • engineered (292)
    Domains in SCOP 1.75: d1fkxa_
  • Heterogens: ZN, PRH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fkxA (A:)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntdaplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq