PDB entry 1fkw

View 1fkw on RCSB PDB site
Description: murine adenosine deaminase (d295e)
Deposited on 1996-02-29, released 1996-08-01
The last revision prior to the SCOP 1.57 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.176
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1fkw__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fkw_ (-)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntedplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq