PDB entry 1fko

View 1fko on RCSB PDB site
Description:
Deposited on 2000-08-10, released 2000-11-03
The last revision prior to the SCOP 1.65 freeze date was dated 2001-02-28, with a file datestamp of 2001-02-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.205
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1fkoa1, d1fkoa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1fkob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fkoA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    gig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fkoB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fkoB (B:)
    spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
    ikkkdstkwrklvdfrelnkrtqdflgiphpaglkknksvtvldvgdayfsvpldedfrk
    ytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymdd
    lyvgsdleigqhrtkieelrqhllrwgelhpdkwtvqpivlpekdswtvndiqklvgkln
    wasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdl
    iaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgk
    tpkfklpiqketwetwwteywqatwipewefvntpplvklwyq