PDB entry 1fkk

View 1fkk on RCSB PDB site
Description: atomic structure of fkbp12, an immunophilin binding protein
Deposited on 1995-08-18, released 1995-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.158
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1fkk__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fkk_ (-)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfvlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiippnatlifdvellkle