PDB entry 1fkk

View 1fkk on RCSB PDB site
Description: atomic structure of fkbp12, an immunophilin binding protein
Class: rotamase
Keywords: fk506 binding protein, fkbp12, cis-trans prolyl-isomerase, rotamase
Deposited on 1995-08-18, released 1995-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.158
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506 binding protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fkka_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fkkA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfvlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiippnatlifdvellkle