PDB entry 1fkj

View 1fkj on RCSB PDB site
Description: atomic structure of fkbp12-fk506, an immunophilin immunosuppressant complex
Deposited on 1995-08-18, released 1995-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1fkj__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fkj_ (-)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle