PDB entry 1fk2

View 1fk2 on RCSB PDB site
Description: structural basis of non-specific lipid binding in maize lipid-transfer protein complexes with myristic acid revealed by high-resolution x-ray crystallography
Class: lipid transport
Keywords: protein-lipid complex, LIPID TRANSPORT
Deposited on 2000-08-09, released 2001-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nonspecific lipid-transfer protein
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fk2a_
  • Heterogens: MYR, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fk2A (A:)
    aiscgqvasaiapcisyargqgsgpsagccsgvrslnnaarttadrraacnclknaaagv
    sglnagnaasipskcgvsipytiststdcsrvn