PDB entry 1fjx

View 1fjx on RCSB PDB site
Description: structure of ternary complex of hhai methyltransferase mutant (t250g) in complex with DNA and adohcy
Class: transferase/DNA
Keywords: AdoMet-dependent Methyltransferase fold protein-DNA-cofactor complex, TRANSFERASE/DNA COMPLEX
Deposited on 2000-08-08, released 2000-12-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.207
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hhai DNA methyltransferase
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05102 (0-326)
      • mutation (249)
    Domains in SCOPe 2.01: d1fjxa_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*gp*ap*tp*ap*gp*cp*gp*cp*tp*ap*tp*c)-3')
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*ap*tp*ap*gp*cp*gp*cp*tp*ap*tp*c)-3')
    Species: synthetic, synthetic
  • Heterogens: SO4, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fjxA (A:)
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaiglsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.