PDB entry 1fjn

View 1fjn on RCSB PDB site
Description: solution structure and activity of the four disulfide bond mediterranean mussel defensin mgd-1
Deposited on 2000-08-08, released 2000-12-20
The last revision prior to the SCOP 1.71 freeze date was dated 2000-12-20, with a file datestamp of 2000-12-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1fjna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjnA (A:)
    gfgcpnnyqchrhcksipgrcggycggwhrlrctcyrcg