PDB entry 1fjl

View 1fjl on RCSB PDB site
Description: homeodomain from the drosophila paired protein bound to a DNA oligonucleotide
Class: transcription/DNA
Keywords: DNA-binding protein, DNA, paired box, transcription regulation, transcription/DNA complex
Deposited on 1995-12-17, released 1996-06-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: paired protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06601 (Start-80)
      • engineered (20)
      • engineered (66)
    Domains in SCOPe 2.05: d1fjla_
  • Chain 'B':
    Compound: paired protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06601
      • engineered (20)
      • engineered (66)
    Domains in SCOPe 2.05: d1fjlb_
  • Chain 'C':
    Compound: paired protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06601
      • engineered (20)
      • engineered (66)
    Domains in SCOPe 2.05: d1fjlc_
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*tp*ap*ap*tp*cp*tp*gp*ap*tp*tp*ap*c)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*tp*gp*tp*ap*ap*tp*cp*ap*gp*ap*tp*tp*ap*t)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*tp*gp*tp*ap*ap*tp*cp*tp*gp*ap*tp*tp*ap*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fjlA (A:)
    edisdcesepgialkrkqrrsrttfsasqldelerafertqypdiytreelaqrtnltea
    riqvwfqnrrarlrkqhtsvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fjlA (A:)
    kqrrsrttfsasqldelerafertqypdiytreelaqrtnlteariqvwfqnrrarlrkq
    htsvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fjlB (B:)
    edisdcesepgialkrkqrrsrttfsasqldelerafertqypdiytreelaqrtnltea
    riqvwfqnrrarlrkqhtsvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fjlB (B:)
    qrrsrttfsasqldelerafertqypdiytreelaqrtnlteariqvwfqnrrarlrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fjlC (C:)
    edisdcesepgialkrkqrrsrttfsasqldelerafertqypdiytreelaqrtnltea
    riqvwfqnrrarlrkqhtsvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fjlC (C:)
    kqrrsrttfsasqldelerafertqypdiytreelaqrtnlteariqvwfqnrrarlrk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.