PDB entry 1fjj

View 1fjj on RCSB PDB site
Description: crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family
Class: lipid binding protein
Keywords: PEPB family, LIPID BINDING PROTEIN
Deposited on 2000-08-08, released 2001-07-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.18
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical 17.1 kda protein in modc-bioa intergenic region
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12994 (1-158)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (23)
      • modified residue (87)
      • modified residue (138)
      • modified residue (156)
    Domains in SCOPe 2.06: d1fjja1, d1fjja2
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjjA (A:)
    amklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgs
    gwwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryift
    vhaldieridvdegasgamvgfnvhfhslasasitamfs