PDB entry 1fjj

View 1fjj on RCSB PDB site
Description: crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family
Deposited on 2000-08-08, released 2001-07-18
The last revision prior to the SCOP 1.67 freeze date was dated 2001-07-18, with a file datestamp of 2001-07-18.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.18
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1fjja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fjjA (A:)
amklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgs
gwwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryift
vhaldieridvdegasgamvgfnvhfhslasasitamfs