PDB entry 1fjg

View 1fjg on RCSB PDB site
Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Deposited on 2000-08-08, released 2000-09-25
The last revision prior to the SCOP 1.61 freeze date was dated 2000-09-25, with a file datestamp of 2000-09-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.221
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.61: d1fjgb_
  • Chain 'C':
    Domains in SCOP 1.61: d1fjgc1, d1fjgc2
  • Chain 'D':
    Domains in SCOP 1.61: d1fjgd_
  • Chain 'E':
    Domains in SCOP 1.61: d1fjge1, d1fjge2
  • Chain 'F':
    Domains in SCOP 1.61: d1fjgf_
  • Chain 'G':
    Domains in SCOP 1.61: d1fjgg_
  • Chain 'H':
    Domains in SCOP 1.61: d1fjgh_
  • Chain 'I':
    Domains in SCOP 1.61: d1fjgi_
  • Chain 'J':
    Domains in SCOP 1.61: d1fjgj_
  • Chain 'K':
    Domains in SCOP 1.61: d1fjgk_
  • Chain 'L':
    Domains in SCOP 1.61: d1fjgl_
  • Chain 'M':
    Domains in SCOP 1.61: d1fjgm_
  • Chain 'N':
    Domains in SCOP 1.61: d1fjgn_
  • Chain 'O':
    Domains in SCOP 1.61: d1fjgo_
  • Chain 'P':
    Domains in SCOP 1.61: d1fjgp_
  • Chain 'Q':
    Domains in SCOP 1.61: d1fjgq_
  • Chain 'R':
    Domains in SCOP 1.61: d1fjgr_
  • Chain 'S':
    Domains in SCOP 1.61: d1fjgs_
  • Chain 'T':
    Domains in SCOP 1.61: d1fjgt_
  • Chain 'V':
    Domains in SCOP 1.61: d1fjgv_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgB (B:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
    ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
    ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqeae
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgC (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgD (D:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvqenlviefysr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgE (E:)
    dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
    nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
    srnpiniayatmealrqlrtkadverlrkg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgF (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgG (G:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgH (H:)
    mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
    vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
    drearklgvggelicevw
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgI (I:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgJ (J:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgK (K:)
    krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
    kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgL (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkeaa
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgM (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgN (N:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgO (O:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgP (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqe
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgQ (Q:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
    srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgR (R:)
    psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
    lgllpfteklvrk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgS (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyrghgk
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgT (T:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjgV (V:)
    gkgdrrtrrgkiwrgtygkyrprk