PDB entry 1fje

View 1fje on RCSB PDB site
Description: solution structure of nucleolin rbd12 in complex with snre RNA
Class: structural protein/RNA
Keywords: RNP, RBD, RRM, RNA binding domain, RNA-protein complex, Nucleolus, STRUCTURAL PROTEIN/RNA COMPLEX
Deposited on 2000-08-08, released 2001-01-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: snre RNA
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: nucleolin rbd12
    Species: Mesocricetus auratus [TaxId:10036]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08199 (0-174)
      • conflict (0-3)
      • conflict (36)
    Domains in SCOPe 2.08: d1fjeb1, d1fjeb2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjeB (B:)
    gshmvegsesttpfnlfignlnpnksvaelkvaiselfakndlavvdvrtgtnrkfgyvd
    fesaedlekaleltglkvfgneiklekpkgrdskkvraartllaknlsfnitedelkevf
    edaleirlvsqdgkskgiayiefkseadaeknleekqgaeidgrsvslyytgekg