PDB entry 1fjd

View 1fjd on RCSB PDB site
Description: human parvulin-like peptidyl prolyl cis/trans isomerase, hpar14
Class: isomerase
Keywords: Parvulin, Peptidyl prolyl cis/trans isomerase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2000-08-08, released 2001-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptidyl prolyl cis/trans isomerase (ppiase)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y237 (0-103)
    • engineered (0-1)
  Domains in SCOPe 2.08: d1fjda_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fjdA (A:)
  gsgpkgggnavkvrhilcekhgkimeameklksgmrfnevaaqysedkarqggdlgwmtr
  gsmvgpfqeaafalpvsgmdkpvftdppvktkfgyhiimvegrk