PDB entry 1fjc

View 1fjc on RCSB PDB site
Description: solution structure of nucleolin rbd2
Deposited on 2000-08-07, released 2000-10-16
The last revision prior to the SCOP 1.69 freeze date was dated 2000-10-16, with a file datestamp of 2000-10-16.
Experiment type: NMR33
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1fjca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjcA (A:)
    shmledpctskkvraartllaknlsfnitedelkevfedaleirlvsqdgkskgiayief
    kseadaeknleekqgaeidgrsvslyytgekggtrg