PDB entry 1fj1

View 1fj1 on RCSB PDB site
Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
Class: immune system
Keywords: ospa, lyme disease, antibody fab fragment, neutralizing epitope, immune system
Deposited on 2000-08-07, released 2000-10-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hybridoma antibody la2 (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FJ1 (0-212)
    Domains in SCOPe 2.03: d1fj1a1, d1fj1a2
  • Chain 'B':
    Compound: hybridoma antibody la2 (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FJ1 (0-212)
    Domains in SCOPe 2.03: d1fj1b1, d1fj1b2
  • Chain 'C':
    Compound: hybridoma antibody la2 (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FJ1 (0-212)
    Domains in SCOPe 2.03: d1fj1c1, d1fj1c2
  • Chain 'D':
    Compound: hybridoma antibody la2 (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FJ1 (0-212)
    Domains in SCOPe 2.03: d1fj1d1, d1fj1d2
  • Chain 'E':
    Compound: Outer surface protein A
    Species: Borrelia burgdorferi [TaxId:224326]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14013 (Start-256)
      • variant (22)
      • engineered (67)
      • variant (132)
      • variant (147)
    Domains in SCOPe 2.03: d1fj1e_
  • Chain 'F':
    Compound: Outer surface protein A
    Species: Borrelia burgdorferi [TaxId:224326]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14013 (Start-256)
      • variant (22)
      • engineered (67)
      • variant (132)
      • variant (147)
    Domains in SCOPe 2.03: d1fj1f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj1A (A:)
    diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps
    rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj1B (B:)
    qiqlvqsgpelkkpgetvkisckasgytftdysmywvkqapgkglkrmgwintetgepty
    addfkgrfalsldtsastaylhisnlknedtatyfcargldswgqgtsvtvssakttpps
    vyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsss
    vtvpsstwpsqtvtcsvahpassttvdkkleps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj1C (C:)
    diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps
    rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj1D (D:)
    qiqlvqsgpelkkpgetvkisckasgytftdysmywvkqapgkglkrmgwintetgepty
    addfkgrfalsldtsastaylhisnlknedtatyfcargldswgqgtsvtvssakttpps
    vyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsss
    vtvpsstwpsqtvtcsvahpassttvdkkleps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fj1E (E:)
    akqnvssldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvl
    egvkadkckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevseki
    itradgtrleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksge
    vsvelndtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtkle
    gsaveitkldeiknalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fj1E (E:)
    sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
    kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
    trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
    dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
    tkldeiknalk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fj1F (F:)
    akqnvssldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvl
    egvkadkckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevseki
    itradgtrleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksge
    vsvelndtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtkle
    gsaveitkldeiknalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fj1F (F:)
    sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
    kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
    trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
    dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
    tkldeiknalk