PDB entry 1fj0

View 1fj0 on RCSB PDB site
Description: structure determination of the ferricytochrome c2 from rhodopseudomonas palustris
Class: electron transport
Keywords: electron carrier, heme protein, electron transport
Deposited on 2000-08-07, released 2002-01-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c2
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00091 (0-113)
      • modified residue (0)
      • conflict (28)
      • conflict (63-64)
      • conflict (67)
      • conflict (79)
    Domains in SCOPe 2.01: d1fj0a_
  • Chain 'B':
    Compound: cytochrome c2
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00091 (0-113)
      • modified residue (0)
      • conflict (28)
      • conflict (63-64)
      • conflict (67)
      • conflict (79)
    Domains in SCOPe 2.01: d1fj0b_
  • Chain 'C':
    Compound: cytochrome c2
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00091 (0-113)
      • modified residue (0)
      • conflict (28)
      • conflict (63-64)
      • conflict (67)
      • conflict (79)
    Domains in SCOPe 2.01: d1fj0c_
  • Chain 'D':
    Compound: cytochrome c2
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00091 (0-113)
      • modified residue (0)
      • conflict (28)
      • conflict (63-64)
      • conflict (67)
      • conflict (79)
    Domains in SCOPe 2.01: d1fj0d_
  • Heterogens: SO4, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj0A (A:)
    edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
    dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj0B (B:)
    edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
    dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj0C (C:)
    edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
    dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj0D (D:)
    edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
    dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk