PDB entry 1fj0
View 1fj0 on RCSB PDB site
Description: structure determination of the ferricytochrome c2 from rhodopseudomonas palustris
Class: electron transport
Keywords: electron carrier, heme protein, electron transport
Deposited on
2000-08-07, released
2002-01-16
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.57
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cytochrome c2
Species: Rhodopseudomonas palustris [TaxId:1076]
Database cross-references and differences (RAF-indexed):
- Uniprot P00091 (0-113)
- modified residue (0)
- conflict (28)
- conflict (63-64)
- conflict (67)
- conflict (79)
Domains in SCOPe 2.01: d1fj0a_ - Chain 'B':
Compound: cytochrome c2
Species: Rhodopseudomonas palustris [TaxId:1076]
Database cross-references and differences (RAF-indexed):
- Uniprot P00091 (0-113)
- modified residue (0)
- conflict (28)
- conflict (63-64)
- conflict (67)
- conflict (79)
Domains in SCOPe 2.01: d1fj0b_ - Chain 'C':
Compound: cytochrome c2
Species: Rhodopseudomonas palustris [TaxId:1076]
Database cross-references and differences (RAF-indexed):
- Uniprot P00091 (0-113)
- modified residue (0)
- conflict (28)
- conflict (63-64)
- conflict (67)
- conflict (79)
Domains in SCOPe 2.01: d1fj0c_ - Chain 'D':
Compound: cytochrome c2
Species: Rhodopseudomonas palustris [TaxId:1076]
Database cross-references and differences (RAF-indexed):
- Uniprot P00091 (0-113)
- modified residue (0)
- conflict (28)
- conflict (63-64)
- conflict (67)
- conflict (79)
Domains in SCOPe 2.01: d1fj0d_ - Heterogens: SO4, HEM, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1fj0A (A:)
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1fj0B (B:)
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1fj0C (C:)
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1fj0D (D:)
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk