PDB entry 1fiz

View 1fiz on RCSB PDB site
Description: three dimensional structure of beta-acrosin from boar spermatozoa
Class: hydrolase
Keywords: anti-parallel beta-barrel, HYDROLASE
Deposited on 2000-08-07, released 2000-11-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.212
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-acrosin heavy chain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fiz.1
  • Chain 'L':
    Compound: beta-acrosin light chain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fiz.1
  • Heterogens: SO4, PBZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fizA (A:)
    vvggmsaepgawpwmvslqifmyhnnrryhtcggillnshwvltaahcfknkkkvtdwrl
    ifganevvwgsnkpvkpplqerfveeiiihekyvsgleindialikitppvpcgpfigpg
    clpqfkagpprapqtcwvtgwgylkekgprtsptlqearvalidlelcnstrwyngrirs
    tnvcagyprgkidtcqgdsggplmcrdraentfvvvgitswgvgcarakrpgvytstwpy
    lnwiaskigsnalqmvqlgtppr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1fizL (L:)
    rdnatcdgpcglrfrqklesgmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fizL (L:)
    atcdgpcglrfrq