PDB entry 1fiz

View 1fiz on RCSB PDB site
Description:
Deposited on 2000-08-07, released 2000-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-08, with a file datestamp of 2000-11-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.212
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fiz.1
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fiz.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fizA (A:)
    vvggmsaepgawpwmvslqifmyhnnrryhtcggillnshwvltaahcfknkkkvtdwrl
    ifganevvwgsnkpvkpplqerfveeiiihekyvsgleindialikitppvpcgpfigpg
    clpqfkagpprapqtcwvtgwgylkekgprtsptlqearvalidlelcnstrwyngrirs
    tnvcagyprgkidtcqgdsggplmcrdraentfvvvgitswgvgcarakrpgvytstwpy
    lnwiaskigsnalqmvqlgtppr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fizL (L:)
    atcdgpcglrfrq