PDB entry 1fiy

View 1fiy on RCSB PDB site
Description: three-dimensional structure of phosphoenolpyruvate carboxylase from escherichia coli at 2.8 a resolution
Deposited on 1998-05-02, released 1999-02-09
The last revision prior to the SCOP 1.71 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1fiy__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1fiy_ (-)
    mneqysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttl
    qnlsndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsed
    tikkaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrq
    liaqswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvef
    vpvrftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpell
    alvgeegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacy
    qslqacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyes
    wseadkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktp
    sdvlavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmig
    ysdsakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqp
    pgslkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdel
    sviscdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpakrrptggveslraipwifa
    wtqnrlmlpawlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlae
    yydqrlvdkalwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdpln
    vlqaellhrsrqaekegqepdprveqalmvtiagiaagmrntg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiy_ (-)
    qysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttlqnl
    sndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsedtik
    kaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrqlia
    qswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvefvpv
    rftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpellalv
    geegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacyqsl
    qacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyeswse
    adkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktpsdv
    lavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmigysd
    sakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqppgs
    lkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdelsvi
    scdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpaveslraipwifawtqnrlmlpa
    wlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlaeyydqrlvdka
    lwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdplnvlqaellhrs
    rqaekegqepdprveqalmvtiagiaagmrntg