PDB entry 1fiw

View 1fiw on RCSB PDB site
Description: three-dimensional structure of beta-acrosin from ram spermatozoa
Class: hydrolase
Keywords: anti-parallel beta-barrel, HYDROLASE
Deposited on 2000-08-07, released 2000-11-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-acrosin heavy chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fiw.1
  • Chain 'L':
    Compound: beta-acrosin light chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FIW
    Domains in SCOPe 2.01: d1fiw.1
  • Heterogens: PBZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fiwA (A:)
    iiggqdaahgawpwmvslqiftyhnnrryhvcggsllnsqwlltaahcfrikkkvtdwrl
    ifgakevewgtnkpvkpplqeryvekiiihekysasseandialmkitppvtcghfigpg
    clpqfragpprvpqtcwvagwgflqenarrtspmlqearvdlidlglcnstrwyngrirs
    tnvcagypegkidtcqgdsggplmckdsaensyvvvgitswgvgcarakrpgvytstwsy
    lnwiaskigstavhmiqlptaspastpgaqassgsvqpsvrppwffqqit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiwA (A:)
    iiggqdaahgawpwmvslqiftyhnnrryhvcggsllnsqwlltaahcfrikkkvtdwrl
    ifgakevewgtnkpvkpplqeryvekiiihekysasseandialmkitppvtcghfigpg
    clpqfragpprvpqtcwvagwgflqenarrtspmlqearvdlidlglcnstrwyngrirs
    tnvcagypegkidtcqgdsggplmckdsaensyvvvgitswgvgcarakrpgvytstwsy
    lnwiaskigstavhmiqlpt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1fiwL (L:)
    dnttcdgpcgvrfrqnrqggvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiwL (L:)
    ttcdgpcgvrfrqn