PDB entry 1fiw

View 1fiw on RCSB PDB site
Description: three-dimensional structure of beta-acrosin from ram spermatozoa
Deposited on 2000-08-07, released 2000-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-08, with a file datestamp of 2000-11-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fiw.1
  • Chain 'L':
    Domains in SCOP 1.55: d1fiw.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fiwA (A:)
    iiggqdaahgawpwmvslqiftyhnnrryhvcggsllnsqwlltaahcfrikkkvtdwrl
    ifgakevewgtnkpvkpplqeryvekiiihekysasseandialmkitppvtcghfigpg
    clpqfragpprvpqtcwvagwgflqenarrtspmlqearvdlidlglcnstrwyngrirs
    tnvcagypegkidtcqgdsggplmckdsaensyvvvgitswgvgcarakrpgvytstwsy
    lnwiaskigstavhmiqlpt
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fiwL (L:)
    ttcdgpcgvrfrqn