PDB entry 1fiv

View 1fiv on RCSB PDB site
Description: structure of an inhibitor complex of proteinase from feline immunodeficiency virus
Deposited on 1995-05-04, released 1995-07-31
The last revision prior to the SCOP 1.71 freeze date was dated 1999-06-10, with a file datestamp of 1999-06-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.148
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1fiva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fivA (A:)
  vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
  rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm