PDB entry 1fiq

View 1fiq on RCSB PDB site
Description:
Deposited on 2000-08-04, released 2000-10-04
The last revision prior to the SCOP 1.69 freeze date was dated 2000-10-04, with a file datestamp of 2000-10-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1fiqa1, d1fiqa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1fiqb1, d1fiqb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1fiqc1, d1fiqc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fiqA (A:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiqA (A:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fiqB (B:)
    kdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmii
    cpawipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfag
    kqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllg
    peeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggm
    adrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkf
    yltvlkklgkdskdkcgkldptytsatllfqkhppaniqlfqevpngqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiqB (B:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fiqC (C:)
    edtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvp
    gfvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvty
    edlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethct
    iaipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvs
    vavalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagn
    srdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmse
    vavtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnk
    encwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqv
    askalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknp
    dgswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltg
    dhknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstyki
    pafgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnn
    tkelfrldspatpekirnacvdkfttlcvtgapgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiqC (C:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkftt