PDB entry 1fiq

View 1fiq on RCSB PDB site
Description: crystal structure of xanthine oxidase from bovine milk
Class: oxidoreductase
Keywords: Xanthine Oxidase, OXIDOREDUCTASE
Deposited on 2000-08-04, released 2000-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xanthine oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fiqa1, d1fiqa2
  • Chain 'B':
    Compound: xanthine oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fiqb1, d1fiqb2
  • Chain 'C':
    Compound: xanthine oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fiqc1, d1fiqc2
  • Heterogens: FES, MTE, MOS, SAL, FAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fiqA (A:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiqA (A:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fiqB (B:)
    kdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmii
    cpawipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfag
    kqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllg
    peeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggm
    adrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkf
    yltvlkklgkdskdkcgkldptytsatllfqkhppaniqlfqevpngqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiqB (B:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fiqC (C:)
    edtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvp
    gfvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvty
    edlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethct
    iaipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvs
    vavalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagn
    srdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmse
    vavtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnk
    encwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqv
    askalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknp
    dgswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltg
    dhknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstyki
    pafgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnn
    tkelfrldspatpekirnacvdkfttlcvtgapgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiqC (C:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkftt