PDB entry 1fip

View 1fip on RCSB PDB site
Description: the structure of fis mutant pro61ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1994-09-26, released 1995-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: factor for inversion stimulation (fis)
  Species: Escherichia coli [TaxId:562]
  Gene: FIS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11028 (Start-97)
    • engineered mutation (60)
  Domains in SCOPe 2.08: d1fipa_
• Chain 'B':
  Compound: factor for inversion stimulation (fis)
  Species: Escherichia coli [TaxId:562]
  Gene: FIS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11028 (Start-97)
    • engineered mutation (60)
  Domains in SCOPe 2.08: d1fipb_
• Chain 'C':
  Compound: unknown peptide, possibly part of the unobserved residues in entity 1
  Database cross-references and differences (RAF-indexed):
  • PDB 1FIP (0-3)
• Chain 'D':
  Compound: unknown peptide, possibly part of the unobserved residues in entity 1
  Database cross-references and differences (RAF-indexed):
  • PDB 1FIP (0-3)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1fipA (A:)
  mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
  alldmvmqytrgnqtraalmmginrgtlrkklkkygmn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1fipA (A:)
  plrdsvkqalknyfaqlngqdvndlyelvlaeveqalldmvmqytrgnqtraalmmginr
  gtlrkklkkygmn
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1fipB (B:)
  mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
  alldmvmqytrgnqtraalmmginrgtlrkklkkygmn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1fipB (B:)
  plrdsvkqalknyfaqlngqdvndlyelvlaeveqalldmvmqytrgnqtraalmmginr
  gtlrkklkkygmn
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.