PDB entry 1fim

View 1fim on RCSB PDB site
Description: macrophage migration inhibitory factor
Deposited on 1996-01-31, released 1996-07-11
The last revision prior to the SCOP 1.57 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1fim__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fim_ (-)
    pafivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtsdpcalcs
    lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydana