PDB entry 1fig

View 1fig on RCSB PDB site
Description: routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-01-07, released 1994-05-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.22
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa 1f7 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAA51043 (0-215)
    Domains in SCOP 1.75: d1figh1, d1figh2
  • Chain 'L':
    Compound: igg1-kappa 1f7 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAA51141 (0-214)
    Domains in SCOP 1.75: d1figl1, d1figl2
  • Heterogens: TSA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1figH (H:)
    dvqlqqsgpelekpgasvkisckasgfslpghninwivqrngkslewignidpyyggtnf
    npkfkgkatltvdkssstlymhltslqsedsavyycarrrdgnygftywgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1figL (L:)
    envltqspaimsaspgekvtmacrasssvsstylhwyqqksgaspklliystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqysgypltfgagtklelkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec