PDB entry 1fig

View 1fig on RCSB PDB site
Description:
Deposited on 1994-01-07, released 1994-05-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 3 Å
R-factor: 0.22
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1figh1, d1figh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1figl1, d1figl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1figH (H:)
    dvqlqqsgpelekpgasvkisckasgfslpghninwivqrngkslewignidpyyggtnf
    npkfkgkatltvdkssstlymhltslqsedsavyycarrrdgnygftywgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1figL (L:)
    envltqspaimsaspgekvtmacrasssvsstylhwyqqksgaspklliystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqysgypltfgagtklelkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec