PDB entry 1fi8

View 1fi8 on RCSB PDB site
Description:
Deposited on 2000-08-03, released 2000-09-13
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-13, with a file datestamp of 2000-09-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fi8a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fi8b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fi8.1
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fi8.1
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fi8.2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fi8.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fi8A (A:)
    iiggheakphsrpymaylqimdeysgskkcggfliredfvltaahcsgskiqvtlgahni
    keqekmqqiipvvkiiphpaynsktisndimllklkskakrssavkplnlprrnvkvkpg
    dvcyvagwgklgpmgkysdtlqeveltvqedqkcesylknyfdkaneicagdpkikrasf
    rgdsggplvckkvaagivsygqndgstpraftkvstflswikktmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fi8A (A:)
    iiggheakphsrpymaylqimdeysskkcggfliredfvltaahcsgskiqvtlgahnik
    eqekmqqiipvvkiiphpaynsktisndimllklkskakrssavkplnlprrnvkvkpgd
    vcyvagwgklgpmgkysdtlqeveltvqedqkcesylknyfdkaneicagdpkikrasfr
    gdsggplvckkvaagivsygqndgstpraftkvstflswikktmkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fi8B (B:)
    iiggheakphsrpymaylqimdeysgskkcggfliredfvltaahcsgskiqvtlgahni
    keqekmqqiipvvkiiphpaynsktisndimllklkskakrssavkplnlprrnvkvkpg
    dvcyvagwgklgpmgkysdtlqeveltvqedqkcesylknyfdkaneicagdpkikrasf
    rgdsggplvckkvaagivsygqndgstpraftkvstflswikktmkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fi8C (C:)
    plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
    gwgydyyvfdkvsspiepd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fi8C (C:)
    plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdclhrlggklenktleg
    wgydyyvfdkvsspiepd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fi8D (D:)
    kfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekidnavvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fi8E (E:)
    plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
    gwgydyyvfdkvsspiepd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fi8E (E:)
    plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdclhrlggklenktleg
    wgydyyvfdsspiepd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fi8F (F:)
    kfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekidnavvr