PDB entry 1fi8

View 1fi8 on RCSB PDB site
Description: rat granzyme b [n66q] complexed to ecotin [81-84 iepd]
Class: hydrolase/hydrolase inhibitor
Keywords: complex (serine protease/inhibitor), protease substrate interactions, beta strand structure, chymotrypsin fold, granzyme B, ecotin, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-08-03, released 2000-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: natural killer cell protease 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18291 (0-End)
      • engineered (51)
    Domains in SCOPe 2.07: d1fi8a_
  • Chain 'B':
    Compound: natural killer cell protease 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18291 (0-End)
      • engineered (51)
    Domains in SCOPe 2.07: d1fi8b_
  • Chain 'C':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (5-83)
      • engineered (80-83)
    Domains in SCOPe 2.07: d1fi8.1
  • Chain 'D':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fi8.1
  • Chain 'E':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (5-83)
      • engineered (80-83)
    Domains in SCOPe 2.07: d1fi8.2
  • Chain 'F':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fi8.2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fi8A (A:)
    iiggheakphsrpymaylqimdeysgskkcggfliredfvltaahcsgskiqvtlgahni
    keqekmqqiipvvkiiphpaynsktisndimllklkskakrssavkplnlprrnvkvkpg
    dvcyvagwgklgpmgkysdtlqeveltvqedqkcesylknyfdkaneicagdpkikrasf
    rgdsggplvckkvaagivsygqndgstpraftkvstflswikktmkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fi8A (A:)
    iiggheakphsrpymaylqimdeysskkcggfliredfvltaahcsgskiqvtlgahnik
    eqekmqqiipvvkiiphpaynsktisndimllklkskakrssavkplnlprrnvkvkpgd
    vcyvagwgklgpmgkysdtlqeveltvqedqkcesylknyfdkaneicagdpkikrasfr
    gdsggplvckkvaagivsygqndgstpraftkvstflswikktmkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fi8B (B:)
    iiggheakphsrpymaylqimdeysgskkcggfliredfvltaahcsgskiqvtlgahni
    keqekmqqiipvvkiiphpaynsktisndimllklkskakrssavkplnlprrnvkvkpg
    dvcyvagwgklgpmgkysdtlqeveltvqedqkcesylknyfdkaneicagdpkikrasf
    rgdsggplvckkvaagivsygqndgstpraftkvstflswikktmkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fi8B (B:)
    iiggheakphsrpymaylqimdeysgskkcggfliredfvltaahcsgskiqvtlgahni
    keqekmqqiipvvkiiphpaynsktisndimllklkskakrssavkplnlprrnvkvkpg
    dvcyvagwgklgpmgkysdtlqeveltvqedqkcesylknyfdkaneicagdpkikrasf
    rgdsggplvckkvaagivsygqndgstpraftkvstflswikktmkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fi8C (C:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvsspiepd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fi8C (C:)
    plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdclhrlggklenktleg
    wgydyyvfdkvsspiepd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fi8D (D:)
    macpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fi8D (D:)
    kfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekidnavvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fi8E (E:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvsspiepd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fi8E (E:)
    plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdclhrlggklenktleg
    wgydyyvfdsspiepd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fi8F (F:)
    macpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fi8F (F:)
    kfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekidnavvr