PDB entry 1fi6

View 1fi6 on RCSB PDB site
Description: solution structure of the reps1 eh domain
Deposited on 2000-08-03, released 2001-07-18
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-18, with a file datestamp of 2001-07-18.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1fi6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fi6A (A:)
    wkitdeqrqyyvnqfktiqpdlngfipgsaakefftksklpilelshiwelsdfdkdgal
    tldefcaafhlvvarkngydlpeklpeslmpk