PDB entry 1fi5

View 1fi5 on RCSB PDB site
Description: nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i.
Deposited on 2000-08-03, released 2000-08-23
The last revision prior to the SCOP 1.65 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1fi5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fi5A (A:)
    mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdg
    dknndgridydeflefmkgve